Sign In | Join Free | My howtoaddlikebutton.com
howtoaddlikebutton.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Flavour and Fragrance >

Cjc 1295 With Ipamorelin

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cjc 1295 with ipamorelin

    All cjc 1295 with ipamorelin wholesalers & cjc 1295 with ipamorelin manufacturers come from members. We doesn't provide cjc 1295 with ipamorelin products or service, please contact them directly and verify their companies info carefully.

    Total 11517 products from cjc 1295 with ipamorelin Manufactures & Suppliers
    Wholesale  from china suppliers

    Brand Name:steriodshow

    Model Number:863288-34-0 

    Place of Origin:china manufactuer

    ...Polypeptide Hormones CJC-1295 with DAC Anti Aging Hormones Acetate Growth Hormone CJC-1295 1. Quick Detail: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:HKYC

    Model Number:863288-34-0

    Place of Origin:China

    ...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Wholesale  from china suppliers

    Brand Name:Pharmlab

    Model Number:CJC 1295

    Place of Origin:China

    ... CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone Quick Detail Products Name: CJC 1295 CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 99.5% Appearance: White Powder Alias: CJC-1295...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Pharmagrade Steroids

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    ... Product Name CJC-1295 With DAC Chemical Name CJC-1295 DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873.01 Specification 2mg/10vials/kit Assay 99.5% Appearance White powder CJC-1295 With DAC Description CJC-1295 is basically...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:wumeitech

    Model Number:863288-34-0

    Place of Origin:China

    ... 2mg/vial Cjc-1295 with Dac for Fat Burning 2mg/Vial Legal Safe Peptide CJC-1295 Acetate with Dac Muscle Growth Polypeptide Materials Human Growth Hormone Peptide Manufacturer Supply Cjc-1295 Without Dac with Over 98% Purity CJC-1295 is a terasubstitute...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Biofriend

    Model Number:863288-34-0

    Place of Origin:Wuhan

    ...Hormone Peptides Cjc-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Shuangbojie

    Model Number:863288-34-0

    Place of Origin:China

    ...Effective Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mg.vial 1. CJC 1295 with DAC Information: Product Name CJC-1295 With DAC Chemical Name CJC-1295 DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873.01 ...

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Cjc-1295 with Dac

    Model Number:863288-34-0

    Place of Origin:China

    ...Cjc-1295 with Dac Quick Details Cjc-1295 with Dac Other name Cjc-1295 Dac Cjc-1295 with Dac CAS 863288-34-0 Cjc-1295 with Dac Molecular Formula C165H271N47O46 Cjc-1295 with Dac Molecular Weight 3649.30 Cjc-1295 with Dac Assay 99% Min. Cjc-1295 with...

    HongKong Blue Universal Co., Limited.
    Verified Supplier

    Hongkong

    Wholesale  from china suppliers

    Brand Name:Huao(skype:mia9403)

    Model Number:CJC-1295 with DAC

    Place of Origin:China

    ...Growth Hormone Releasing Hormone GHRH CJC 1295 With DAC For Bodybuilder Contact Abby by trustful@ycgmp.com Skype:mia9403 Whatsapp:+8618826123740 Quick detail : CJC 1295 With DAC Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: ...

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:YC

    Model Number:51753-57-2

    Place of Origin:China

    ...Supply Human Growth Hormone Peptide CJC 1295 With Dac For Increasing Muscle CAS 51753-57-2 Product Name: CJC1295 with DAC Purity (HPLC): 99.0% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% of theoretical Peptide Content...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Blue Dragon

    Model Number:CJC-1295 With DAC 2mg

    Place of Origin:China Manufacturer

    ...CJC-1295 With DAC 2mg Growth Releasing Hormone Peptides GHRH Muscle Mass 1, CJC-1295 With DAC Profile: Product Name: CJC-1295 With DAC / CJC-1295 DAC Specification: 2mg per vial Synonyms: CJC1295(GHRH/DAC), CJC1295 DAC(Drug Affinity Complex), CJC-1295 with...

    Zhuhaishi Shuangbojie Technology Co., Ltd.
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Biopro

    Model Number:PEP-105

    Place of Origin:China

    ...Growth Hormone Peptides CJC - 1295 DAC Lyophilized Peptide Powder CJC-1295 with DAC Description CJC-1295, also known as CJC-1295 DAC, is a synthetic analogue of growth hormone-releasing hormone (GHRH) growth hormone-releasing factor (GRF), ...

    Biopro Chemicals Co., Ltd.
    Verified Supplier

    Shanghai

    Wholesale  from china suppliers

    Brand Name:Shanghai Stero

    Model Number:CJC - 1295 With Dac

    Place of Origin:China

    ...CJC - 1295 With Dac Growth Hormone Petides Bodybuilding Mass Gain Peptide Peptide Profile CJC-1295 With Dac The main application of CJC-1295 is an increase in GH levels, which also leads to an increase in IGF-1 levels...

    Shanghai Stero R&D Co,. Ltd
    Verified Supplier

    Shanghai

    Wholesale  from china suppliers

    Brand Name:Yuancheng

    Model Number:170851-70-4

    Place of Origin:China

    ...CAS 170851-70-4 Injectable Peptides Bodybuilding Pharmaceutical CJC-1295 With DAC CAS: 170851-70-4 MF: C38H49N9O5 MW: 711.853 Assay: 99% Peptide Hormone 2mg/vial CJC-1295 with DAC Bodybuilding Supplements Quality testing: All the steroids...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:CJC-1295 with DAC

    Model Number:5mg/vial * 10vials/kit

    Place of Origin:China

    ...High Purity Pharmaceutical Polypeptide Hormones CJC-1295 with DAC Description: CJC-1295 DAC has shown some amazing results as a growth hormone releasing hormone (GHRH) analog. Not only has CJC-1295 shown the ability to increase growth hormone...

    HongKong Biosuper Health Tech. Co., Ltd
    Verified Supplier

    Hongkong

    Wholesale  from china suppliers

    Brand Name:steroidphar

    Model Number:863288-34-0

    Place of Origin:China

    ...CJC-1295 with DAC 2 mg/ vial Growth Hormone Peptides for Muscle Gain CJC 1295 WITH DAC details: Product Name CJC-1295 With DAC Chemical Name CJC-1295 DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873.01 Molecular Structure...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:CJC-1295

    Model Number:Model Number 863288-34-0

    Place of Origin:China

    ...Cjc-1295 Dac 2mg/vial Peptide Cjc-1295 with Dac for Fat Burning CJC-1295 Basic info. Model Number :863288-34-0 Certification: ISO Delivery Time: 3-7 days Payment Terms: Western union, ...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Ghromone

    Model Number:CJC 1295 with DAC

    Place of Origin:China

    ...Peptide 2 mg CJC 1295 with DAC 99% Puirty Warehouse in USA Gurantee Shipment to UK France Germany Italy Sweden Packaging ...

    Shenzhen Ghormone Biotech Co.,Ltd
    Active Member

    Guangdong

    Wholesale  from china suppliers

    Place of Origin:china

    Brand Name:skype: live :hugerawmandy

    Model Number:sales16@hugeraw.com

    ...Sermorelin Ipamorelin Ghrp-6 CJC-1295 With DAC EU USA Canada Peptides CAS 86168-78-7 USP Sermorelin, TB500, Cjc-1295, Ghrp-6, Ghrp-2, Mgf, Melanotan Peptides Genuine Sermorelin GRF 1-29 NH2 Legit Sermorelin GRF 1-29 NH2 ...

    Hugeraw Health Technology Co.,Ltd
    Active Member

    Jiangsu

    Go to Page
    Inquiry Cart 0