Sign In | Join Free | My howtoaddlikebutton.com
howtoaddlikebutton.com
Products
Search by Category
Wholesale Marketplace
Home > Chemicals > Inorganic Acid >

Cjc Ghrp 6

  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request
    Refine Search

    Business Type

    Region

    cjc ghrp 6

    All cjc ghrp 6 wholesalers & cjc ghrp 6 manufacturers come from members. We doesn't provide cjc ghrp 6 products or service, please contact them directly and verify their companies info carefully.

    Total 14251 products from cjc ghrp 6 Manufactures & Suppliers
    Wholesale  from china suppliers

    Brand Name:Pharm

    Model Number:hannah@chembj.com

    Place of Origin:whatsapp: +86 138 7101 4054

    ... Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building CJC-1295 DAC vs. CJC-1295 No DAC Details: CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are Releasing Hormones (GHRH...

    HUBEI PHARMAGRADE STEROIDS., LTD
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:YIHAN

    Model Number:GHRP 6

    Place of Origin:China

    ...Human Growth Hormone Releasing Peptide , GHRP 6 Peptide 5mg / Vial CAS 87616-84-0 Synonyms: GHRP-6 CAS NO.: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular weight: 873.01 Molar Mass: 873.014 ...

    Yihan Industrial Co.,Ltd.
    Verified Supplier

    Hongkong

    Wholesale  from china suppliers

    Brand Name:Pharmlab

    Model Number:863288-34-0

    Place of Origin:China

    ... No DAC For Body Performance Enhancement 1.Quick detail Product name : CJC-1295 without dac Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 Molecular weight: 3367.2 Molar...

    Pharmlab Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:JNJG

    Model Number:158861-67-7

    Place of Origin:CHINA

    ...No Side Effect Peptide Ghrp-2 White Powder 5mg 10mg vial for Muscle Gain Ghrp-2 Specification: Product Name Ghrp-2 Ghrp-2 Alias Ghrp2 Ghrp-2 CAS 158861-67-7 Ghrp-2 MF C45H55N9O6 Ghrp-2 MW 818.0 Specification 5mg/vial,10mg/vial Apperance...

    Jinan  Jiage  Biological Technology Co.,Ltd
    Verified Supplier

    Shandong

    Wholesale  from china suppliers

    Brand Name:yuancheng

    Model Number:158861-67-7

    Place of Origin:China

    ...GHRP-2 Quick Detail: GHRP-2 release peptide-2 GHRP-2 Specification:10mg/vial 5mg/Vial CAS 158861-67-7 MF C45H55N9O6 Molecular weight 817.9 Production Capacity ...

    Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
    Verified Supplier

    Hunan

    Wholesale  from china suppliers

    Brand Name:shinrezing

    Model Number:87616-84-0

    Place of Origin:China

    ...Name;GHRP-6 Ghrp-6 Chemical Name;Growth hormon releasing peptide-6 Ghrp-6 CAS Number;87616-84-0 Ghrp-6 Molecular Formula;C46H56N12O6 Ghrp-6 Molecular Weight; 873.01 Ghrp-6 specification;5mg/vail or 10mg/vail *10vial/kit Ghrp-6 Assay;99.5% Ghrp-6 Appearance...

    Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Shuangbojie

    Model Number:121062-08-6

    Place of Origin:China

    ... hunger and GH release)? Well let me tell you about GHRP-2 and why this peptide is one step better than its little brother GHRP-6. Unlike GHRP-6 , GHRP-2 does not come with the heavy hunger

    Zhuhaishi Shuangbojie Technology Co., Ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:HKYC

    Model Number:158861-67-7

    Place of Origin:China

    ... :White Powder Purity :99.35% Identity (ESI-MS) :817.97±1.0 Source :Chemical Synthesis Storage :Lyophilized GHRP-2 is stable at room temperature for 90 days,however it should be stored in a freezer...

    Hongkong Yuancheng Gongchuang Technology Co., Limited
    Verified Supplier

    Hong Kong

    Wholesale  from china suppliers

    Brand Name:wumeitech

    Model Number:863288-34-0

    Place of Origin:China

    ...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD...

    Zhuhai Wumei Technology Co.,ltd.
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Nanjian

    Place of Origin:China

    ...White Lyophilized Peptide Powder 2mg CJC 1295 Without DAC CAS 863288-34-0 Product Name CJC-1295 Synonym CJC-1295 Acetate; CJC1295(Without DAC) CAS NO 863288-34-0 Molecular Formula C165H271N47O46 Molecular weight 3649...

    Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
    Verified Supplier

    Shandong

    Wholesale  from china suppliers

    Brand Name:Bodybiological

    Model Number:CJC 1295 with Dac

    Place of Origin:Hubei, China

    ...-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

    Wuhan Body Biological Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:JCJCHEM

    Model Number:87616-84-0

    Place of Origin:China

    ... Muscle Building GHRP-6 Doses: It should be noted right off the bat that GHRP-6 doses are often normally (and ideally) combined with doses of a GHRH analogue, such as Mod GRF 1-29 (CJC-1295...

    JCJ Logis Co.,ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:ChineseHormone

    Model Number:863288-34-0

    Place of Origin:China

    ...Quick detail: CAS No.:863288-34-0 Chemical Name: CJC-1295 without DAC Formula:C152H252N44O42 One Letter Sequence:Y(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2 Three Letter Sequence:H-Tyr-D-Ala-...

    HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
    Verified Supplier

    Hong Kong

    Wholesale  from china suppliers

    Brand Name:Sendi

    Model Number:Pharmaceutical Grade

    Place of Origin:China

    ... Without DAC for Muscle Gaining 2mg/vial Quick detail Product Name CJC-1295 without DAC Chemical Name CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29,Mod GRF 1-29 CAS Number 863288...

    Shenzhen Sendi Biotechnology Co.Ltd.
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:YC

    Model Number:87616-84-0

    Place of Origin:China

    ...99.9% Purity Human Growth Hormone Peptide Ghrp-6 For Muscle Gaining CAS 87616-84-0 Product Name: GHRP-6 (Growth hormone releasing peptide) CAS: 87616-84-0 Molecular Formula: C46H56N12O6 Molecular Weight: 873.01 Purity (...

    Wuhan Yuancheng Technology Development Co., Ltd.
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:Huao

    Model Number:170851-70-4

    Place of Origin:China

    ...Anti Aging Human Growth Peptides GHRP Hexarelin IPamorelin For Bodybuilding Qiuck Details : Ipamorelin Ipamorelin 2mg/vial Ipamorelin CAS No.: 170851-70-4 ...

    Guangzhou Huao Chemical Co.,Ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:steriodshow

    Model Number:863288-34-0

    Place of Origin:china manufactuer

    ... Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile...

    Zhuhaishi Shuangbojie Technology Co.,ltd
    Verified Supplier

    Guangdong

    Wholesale  from china suppliers

    Brand Name:Biofriend

    Model Number:87616-84-0

    Place of Origin:China

    ...-Drying Powder Prohormones Steroids Product Descripition: CAS 87616-84-0 Alias Growth - Hormone Releasing Peptide-6; GHRP6; GHRP 6; Growth - Hormone Releasing Hexapeptide Sequence His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 Specification...

    Wuhan Biofriend Technology Co.,Ltd
    Verified Supplier

    Hubei

    Wholesale  from china suppliers

    Brand Name:HKYC

    Model Number:PEPTIDE POWDER

    Place of Origin:HUBEI,CHINA

    ...Safe Shipping GHRP6 Human Growth Peptide Steroid Ghrp 6 for Muscle Gaining GHRP 6 Basic Info Name Ghrp-6 Alias GHRP-6 Acetate CAS 87616-84-0 M. F C46H56N12O6 M. W 873.01 Purity (HPLC) 98.0%min. Appearance White powder Specification ...

    Hongkong YuanCheng GongChuang Technology Co.,Ltd
    Verified Supplier

    Wholesale  from china suppliers

    Place of Origin:Forever-Inject.cc

    Brand Name:Forever-Inject

    ...GHRP-2 (Growth Hormo ne Releasing Peptide 2) substantially stimulates the pituitary gland's increased natural production of the ...

    ForeverInject International Holdings CO. Limited
    Site Member

    Zhejiang

    Go to Page
    Inquiry Cart 0